SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6T023 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6T023
Domain Number 1 Region: 122-218
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-22
Family I set domains 0.0021
Further Details:      
 
Domain Number 2 Region: 220-313
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-20
Family I set domains 0.00055
Further Details:      
 
Domain Number 3 Region: 27-120
Classification Level Classification E-value
Superfamily Immunoglobulin 3.06e-20
Family I set domains 0.00068
Further Details:      
 
Domain Number 4 Region: 315-400
Classification Level Classification E-value
Superfamily Immunoglobulin 8.55e-18
Family I set domains 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6T023
Sequence length 477
Comment (tr|F6T023|F6T023_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000003984} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MTPTLFFLLYLGLCLGQRMRTQAAGEFPRPSLGAEDGSLVPQGRTVTLRCRGSQEADLYR
LEQKLGNGMSDITDMTTVGTEVNFSLPFVTWNHAGTYYCHYRHSLGWSEPSEPLQLVVTG
LYEEPSLAALPSSEVASGQNVTLQCQTRGWHDWFVLYKDGEEITRGMTQSHGRGRHFEFF
FPAVTSSQNGTYRCYSFQSSSPNAWSSPSASLVLRVSDRLPRPSLRAEDGSLVPQGRTVT
LRCRGSQEADLYRLEQKLGNGMPEVTDMTTVGIEVNFSLPFVTWNHAGTYYCHYRHSLGW
SEPSEPLQLVVTGLYEEPSLAALPSSEVASGQAVTLQCQTRGWHDWFVLYKDGEEITRGM
TQSHGRGLLLPAVTSSQNGTYRCYSFQSTSPNAWSSPSPPPGAQDRGQTQGSHISVTNSY
SPDRAAPGYTMGNLVRLTLAGLVLILLGVLLTENWKSSRESLPEHSDQIIPQDRGER
Download sequence
Identical sequences F6T023
ENSMODP00000003984 ENSMODP00000003984 13616.ENSMODP00000003984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]