SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6T1J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6T1J6
Domain Number 1 Region: 28-172
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-31
Family C-type lectin domain 0.00000348
Further Details:      
 
Domain Number 2 Region: 184-255
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000445
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 239-304
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000709
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6T1J6
Sequence length 308
Comment (tr|F6T1J6|F6T1J6_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000003968} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MVSKMLTILSFLPGLIFAFLLFEQSDAWSYASSKIPMTYDKARIYCQKKYTDLVAIQNKK
EIEYLNNILEFSPSYYWIGIRKINGVWTWVGTQKPLTKEAMNWAPNEPNNKQNNEDCVEI
YIKREKASGMWNDERCTKEKRALCYTASCTTNSCNGHGECVETINDFTCQCYPGFTGFRC
EHAVTCEPHADPENGVLVCSHPVAYFNSSCSVSCDEGYIPTNPNSVTCTSSGKWSGPSPS
CKVIECDALTSPVHGFINCSPNSGTFPWNTTCVFDCESGFELMGSKRLHCSSSGKWDMEK
PVCQGKMP
Download sequence
Identical sequences F6T1J6
ENSMODP00000003968 ENSMODP00000003968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]