SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6T5C1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6T5C1
Domain Number 1 Region: 319-369
Classification Level Classification E-value
Superfamily PH domain-like 0.000000234
Family Ran-binding domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6T5C1
Sequence length 386
Comment (tr|F6T5C1|F6T5C1_XENTR) Nucleoporin 50kDa {ECO:0000313|Ensembl:ENSXETP00000059069} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=nup50 OC=Silurana.
Sequence
MAKRIADKELTDRNWDQEEEAEDAGTFSVASQEVMKTREIKKAKRRNLGSDGERGGAFKG
FKGLFSGTGASLPSFGNGSSXXXXXXXXXXXXXXXSTSLFINLKPASESKPTFGSAFTSR
PLLGAADKPLGTASTNGERALSTSGAALSKAGNSEYNKHLTSLNCSVRDWIVKHVNTNPL
CDLSPIFRDYEKHLSAIEQKYGASSDSGSESDGAAQTKTIPTLHSIKADPIATFSFGSKD
KAPGVPVKTPPDSKPQAAAPTFNFGQKVDSSTLSLIGSGGAPSFSFSTGASSLFGKSTGS
TASSSQESEPSSNTEGKGDGEEEEEPPKAVIQEVKEDDAFYSKKCKLFYKKDNEFKEKGV
GTLHLKPVENRLSSWCAPIPTWATYS
Download sequence
Identical sequences F6T5C1
ENSXETP00000059069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]