SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6T6X4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6T6X4
Domain Number 1 Region: 9-214,260-370
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.69e-54
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6T6X4
Sequence length 372
Comment (tr|F6T6X4|F6T6X4_CALJA) Parvin alpha {ECO:0000313|Ensembl:ENSCJAP00000019069} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PARVA OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLP
LSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLA
EDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVD
SVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEA
LSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLM
GLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRV
LYNLFTKYRNVE
Download sequence
Identical sequences A0A096NAM4 A0A0D9QXB3 A0A287B7K9 A0A2J8UQ07 A0A2K5NL57 A0A2K6AMG8 A0A2K6Q8E4 F6T6X4 I3M4P3 M3YNU9 Q9NVD7 U6CR38
9606.ENSP00000334008 ENSCJAP00000019069 ENSPANP00000009759 ENSP00000447198 ENSMPUP00000013006 ENSGGOP00000014295 ENSGGOP00000014295 ENSCJAP00000019069 ENSSTOP00000004200 XP_003781157.1.62490 XP_004752054.2.14098 XP_005578653.1.63531 XP_010369624.1.97406 XP_011748306.1.29376 XP_011809661.1.43180 XP_011937221.1.92194 XP_014699647.1.49734 XP_017737070.1.44346 ENSMPUP00000013006 ENSSTOP00000004200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]