SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6TA91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6TA91
Domain Number - Region: 138-179
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.00691
Family Outer membrane lipoprotein 0.0049
Further Details:      
 
Domain Number - Region: 45-180
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0142
Family Spectrin repeat 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6TA91
Sequence length 220
Comment (tr|F6TA91|F6TA91_ORNAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSOANP00000028725} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN=LOC103166166 OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
MFICNPFKVLSLQIEKLTLESNEKRKALDSELTETLTAQIELDKTAEAFRRVHGERQELI
KQWENTIEQMQKRDQEIDRCALLATVKQEIRAKEGVIKEKIQFLESETGNNAEYEKKISF
ARQASKLRMEYQNQESSRNQLQNELESLKATVDRTSSDLESLRMEVANLKKEIKEKTHRL
SFTEQNQQTAKLNNVTEISLSLEEKASKMEDILKDEKNVK
Download sequence
Identical sequences F6TA91
ENSOANP00000028725 ENSOANP00000028725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]