SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6TBR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6TBR8
Domain Number 1 Region: 569-657
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-18
Family Third domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 383-476
Classification Level Classification E-value
Superfamily PH domain-like 2.38e-17
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 273-324
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000785
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 486-568
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000994
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  F6TBR8
Domain Number - Region: 17-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0149
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6TBR8
Sequence length 680
Comment (tr|F6TBR8|F6TBR8_HORSE) Fermitin family member 2 {ECO:0000313|Ensembl:ENSECAP00000018235} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=FERMT2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MALDGIRMPDGCYADGTWELSVHVTDLSRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYS
SPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQ
ALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
AILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGG
KTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ
MNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDNEKQYAHWMAACRLASKGKTM
ADSSYNPEVQNILSFLKMQHLNPDPQFIPEQITADINPECLVSPRYLKKYKNKQITARIL
EAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDAGT
GDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRA
KDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences F6TBR8
ENSECAP00000018235 XP_001494711.1.31192 XP_008539217.1.77740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]