SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6TF58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6TF58
Domain Number 1 Region: 126-264
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000157
Family Second domain of FERM 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6TF58
Sequence length 446
Comment (tr|F6TF58|F6TF58_MONDO) FERM domain containing 8 {ECO:0000313|Ensembl:ENSMODP00000012218} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=FRMD8 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEGGEGGPGSGPAERSQRSSVSSVGTRVADILVYLMDDTVVPLAVENVASITAQDLHRSI
REALQLPDVAMEAFALWLISPLLEVQLKPKHQPYKVCRQWSDLLFRFTDAPEDDIAVDEP
SLQFRRNVFFPKRRELQVSSEDVLRLLYEEAKFNVLEVRYPCDAEDCEKLGALVCRLKLG
PYRQGQQTACAVKEKLDSFLPAHLCKRPHGLFTAFRSRGPRLVPGEQGLLSAYQEVKEEA
SGPEAELLARHYAYLHKCHELPYYGCAFFCGEVDKPAQGFLHRGGRKTVTVAINLEGVHV
IDTKEKHVLLGLRFQELSWDYTCSGEDEHVLWLEFDGESEGTPVNKLLKVYSKQAELMSG
LIEYCIELGLAKEPPPPPETKRHKLRRQSSVVCSRIQHLATIDYVDDGKEIKRVKPKRTT
SFFSRQLSLGPATYTAVQPADGLEQS
Download sequence
Identical sequences F6TF58
ENSMODP00000012218 13616.ENSMODP00000012218 ENSMODP00000012218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]