SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6TFJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6TFJ4
Domain Number 1 Region: 88-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000469
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 2 Region: 138-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000324
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 3 Region: 181-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000022
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 42-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000144
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  F6TFJ4
Domain Number - Region: 517-770
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000284
Family Rhodopsin-like 0.031
Further Details:      
 
Domain Number - Region: 5-32
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0201
Family Merozoite surface protein 1 (MSP-1) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6TFJ4
Sequence length 773
Comment (tr|F6TFJ4|F6TFJ4_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000018717} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
SRLCSRCPRNSTCINATACRCHLGFSSWSGEIITNPTDSCDDVNECGPPFGVSCGNFADC
QNVHGSYYCTCSPGYGLVSGATTFRNESENTCQDVDECQQKPRICKGRSVCINTLGSYTC
TCPPGLELNPKDPNLCTDVNECASGHNPCHSSTHCLSVLGSYKCCCRPGWKPVPGSPKGP
DSTVCADVNEYSSGQNSFHNSTVCVNTAGSYRCRCRPGWTPLLGLRDNQRTTVCEEVTFP
TWAPPGIQSQSLSGFFEGVQDLRRHFKPASAQDTVWDLIQSVDELLKAPGDLETLALPDR
HHTVTHLLSGLEEVLRTLAKAVPGGSFTYQSPAGTELSLVIQEQGHGNVTLGQSHARMLL
DWAVAAVAAGSGPTVAGILSNPNMQKLLANASLELDPERQAELEETHESPLYGIQLSLLS
AVNSVFLSNTNTTKLDPKVTFAFSHPVSPGAGRAPQGRDVEKPGTRQELICAFWKGADDG
GGHWATTGCRTLGSWNGNTTCLGFLPGSIAILVNPEDVEDPMLDVITHVGLSLSLLCLLL
AALTFLLCRAIQNTSTSLHLQLSLCLFLAHLLFLTAIDRTEITVLCAIIAGALHYLYLAS
FTWMLLEGLHLFLTARNLTVVNYSSKLMFPVGYGVLAVIVVISAASRPRLYGTSTRCWLR
SESGFIWGFLGPVCAIFSVNLAFFLMTLWILKSRLSPLNSDVSTLQNTSMLTFKATAQLF
ILGCTWCLGILQVRPAAHVMAHLFTIINSLQGVFIFLVYCLLSQQVRKQYGKW
Download sequence
Identical sequences F6TFJ4
9796.ENSECAP00000018717 ENSECAP00000018717 ENSECAP00000018717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]