SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6TG20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6TG20
Domain Number 1 Region: 30-205
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-38
Family SPRY domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6TG20
Sequence length 207
Comment (tr|F6TG20|F6TG20_MACMU) SPRY domain containing 4 {ECO:0000313|Ensembl:ENSMMUP00000001152} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=SPRYD4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MALLFARSLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRGDTGVKYGLVGLE
PTKVALNVERFREWAVVLADTAVTSGRHYWEVTVKRSQQFRIGVADVDMSRDSCIGIDDR
SWVFTYAQRKWYTMLANEKAPIEGIGQPEKVGLLLEYEAQKLSLVDVSQVSVVHTLQTDF
RGPVVPAFALWDGELLTHSGLEVPPGL
Download sequence
Identical sequences F6TG20
ENSMMUP00000001152 9544.ENSMMUP00000001152 NP_001181604.1.72884 ENSMMUP00000001152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]