SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6TGG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6TGG7
Domain Number 1 Region: 26-397
Classification Level Classification E-value
Superfamily SAICAR synthase-like 9.48e-124
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0000048
Further Details:      
 
Domain Number 2 Region: 496-640
Classification Level Classification E-value
Superfamily vWA-like 8.71e-29
Family Integrin A (or I) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6TGG7
Sequence length 863
Comment (tr|F6TGG7|F6TGG7_HORSE) Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha {ECO:0000313|Ensembl:ENSECAP00000006722} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=PIP5K1A OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
VPCSSGMPIKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQD
FYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIE
LCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCV
QAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDISD
GLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDYAQREPLGNEAQHSVDTRR
PAPQKALYSTAMESIQGEARRGGTMETDDYMGGIPARNSKGERLLLYIGIIDILQSYRFI
KKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRR
SGPSSNSCVTYQPSVSGEHKAQVTTKAEVEPGVHFGRPDVLPQTPPLEKISEVSTIPDPY
LSPVVGETLQMLTTSVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITL
ANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVG
SPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVP
PGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEE
ARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFSRTGLPDLSSMTEEEQIAYAMQMS
LQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRN
AMGSLASQATKDNKKDKKEEDKK
Download sequence
Identical sequences F6TGG7
ENSECAP00000006722 ENSECAP00000006722 9796.ENSECAP00000006722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]