SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6TLA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6TLA7
Domain Number 1 Region: 218-362
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-37
Family Third domain of FERM 0.0023
Further Details:      
 
Domain Number 2 Region: 115-220
Classification Level Classification E-value
Superfamily Second domain of FERM 6.41e-31
Family Second domain of FERM 0.0000778
Further Details:      
 
Domain Number 3 Region: 32-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-26
Family First domain of FERM 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6TLA7
Sequence length 556
Comment (tr|F6TLA7|F6TLA7_HORSE) FERM domain containing 3 {ECO:0000313|Ensembl:ENSECAP00000006206} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=FRMD3 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MFASCHCVPRGRRTMKMIHFRSSSIKSLSQEMKCTIRLLDDSEISCHIQRETKGQFLIDH
ICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKSHPPYTMCFRVKFYPHEPLKIK
EELTRYLLFLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFP
KQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFT
AAGFVVFQGNKRIHLVKWPDVCKLKFEGKTFYVIGTQKEKKAMLAFHTSTPAACKHLWKC
GVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQRDPPEVHRTNI
TQSRSSHSLNKQLIINMEPLQPLLPCPCEQEEELPLGEGVPLPKEDNISAPLISSSPVKE
AREYENPPREEEDKIREEPLTISELAYNPSASLLPTPVDDDEIDMLFDCPSRLELEREDT
DSFEDLEADENAFLMAEEEELKEAHQALSWSYDILSGHIRVNPLVKIFSRLLVVGLGLLL
FVFPLLLLLLESAALQ
Download sequence
Identical sequences F6TLA7
ENSECAP00000006206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]