SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6TRQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6TRQ7
Domain Number 1 Region: 244-344
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.18e-35
Family Inhibitor of apoptosis (IAP) repeat 0.00000287
Further Details:      
 
Domain Number 2 Region: 160-247
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 5.37e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0000879
Further Details:      
 
Domain Number 3 Region: 20-107
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.57e-29
Family Inhibitor of apoptosis (IAP) repeat 0.00041
Further Details:      
 
Domain Number 4 Region: 437-534
Classification Level Classification E-value
Superfamily DEATH domain 5.65e-22
Family Caspase recruitment domain, CARD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6TRQ7
Sequence length 541
Comment (tr|F6TRQ7|F6TRQ7_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000000705} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC100010741 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MNLVENIMFLSNMNISNLYELKYDFSCELYRISTYSAFPVNVPVSERSLARAGFYYTGVN
DRVKCFCCGLMLDNWKQGDNAIDKHKQLFPSCAFIQNLTSVNNLESNSQSALSSSLNSAS
CSLSPSSEQSGYFSGSYSSFPLEPVTSRGVEDLSPLNTSPYSYSMSTEEARILTYQAWPL
TFLSPLDLARAGFYYIGPGDMVACFACGGKLSNWEPKDDAMSEHRRHFPHCPFLESQIQE
TSRFNVSNLSMQTHAARVKTFVTWPPQIPVHPEQLANAGFYYVGCNDDVKCFCCDGGLRC
WESGDDPWVEHAKWFPRCEYLIEMKGQQFINQIQASYPHLLEQLLSTSDVPVDENAGLPI
IHFGLGENHAEDAVMMNTSAVRSALEMGFQRRLIKQTVQSKILTTGENYKTVSDLVSDLL
KAEDETREEDEQAEEIESDDLSLIQKNRMALFQHLTCVLPVLNCLLTASVINEQEYDVIK
QKTQISLQVRELIDTIIVKGNIAANIFKKCLRDFDPVLYENLFVEKNMKYIPTEDVSGKI
L
Download sequence
Identical sequences F6TRQ7
13616.ENSMODP00000000705 ENSMODP00000000705 ENSMODP00000000705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]