SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6TSA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6TSA1
Domain Number 1 Region: 282-455
Classification Level Classification E-value
Superfamily vWA-like 7.27e-23
Family Integrin A (or I) domain 0.048
Further Details:      
 
Weak hits

Sequence:  F6TSA1
Domain Number - Region: 690-783
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00366
Family Terpene synthases 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6TSA1
Sequence length 793
Comment (tr|F6TSA1|F6TSA1_HORSE) von Willebrand factor A domain containing 5A {ECO:0000313|Ensembl:ENSECAP00000013393} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=VWA5A OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MVHPCGLLTRREEPVPLKSISVTLSICEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSA
VYSFEAMVDGKKIMAELQDKMKAHTNYENAISQGHQAFLLEEDRCSRDVFCCNVGNLHPG
SKVALTLKYVQELPLEADGALRYVLPAILNPRYCLSGWSEDSCLNMKTPVVPLEDLPYTL
SVVATISSQHGIERIQSNCPLSPIEYHGDDKTSAQVSLADGHKFDRDVELLVYYSEVHTP
SVAVEMGKPKTDSDCLMGDPSAMVSFYPNIPEAQPPITCGEFVFLMDCSGSMQGPMSKQD
KSQLRIEAAKETLILLLKSLPIGCYFNIYGFGSSYEAFFPNSVKYNQHTMEEALRRVNLM
QADLGGTEILRPLKTIYGASSIPGHPLQLFVFTDGEVIDSFSVIKEVRSNSLRHRCFSFG
IGEGASTSLIKGIARVAGGTSEFITGKERMQSKVLRALKRSLQPVVEDVSLSWDLPQGLS
AKMLSPEQTVIFRGQRLIVYAQLTGMMPVTEATGEVCLKYVLQGKSFENKVTFSLQPKLD
ANLTIHRLAAKSFLQTKDMGFRETPANDKKDVLKVSLECGVISSHTAFIAINKDLNKPVQ
RPLVRRAIPRPILMMSMSVMVFFSSFKALKTGPELTSVPTFLYFICGTPTTVWLAKQCHI
SPEMETARSSSNRTNLETRNTVFGNEHLVQLISLQKANGSWDLNEGLAVVLGMSLEDVLA
ALPLKNVDSSSWATVLAVLWLHTYNKDLQYEWELLERKAVAWIRFHAGSIMHVLVKAAVA
FLKSSVDPTMFAF
Download sequence
Identical sequences F6TSA1
ENSECAP00000013393 9796.ENSECAP00000013393 ENSECAP00000013393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]