SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6TWZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6TWZ5
Domain Number 1 Region: 194-395
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.24e-53
Family DBL homology domain (DH-domain) 0.00000157
Further Details:      
 
Domain Number 2 Region: 2-218
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.37e-37
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 383-550
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-26
Family Pleckstrin-homology domain (PH domain) 0.0082
Further Details:      
 
Domain Number 4 Region: 668-769,846-872
Classification Level Classification E-value
Superfamily SH2 domain 1.23e-24
Family SH2 domain 0.00086
Further Details:      
 
Domain Number 5 Region: 796-874
Classification Level Classification E-value
Superfamily SH3-domain 2.04e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 6 Region: 571-657
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000774
Family SH3-domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6TWZ5
Sequence length 878
Comment (tr|F6TWZ5|F6TWZ5_HORSE) Vav guanine nucleotide exchange factor 2 {ECO:0000313|Ensembl:ENSECAP00000013813} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=VAV2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHNV
AQNKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEV
QQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMAPLRLVLSPADMAAI
FINLEDLIKVHHSFLRAIDVSMMAGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQL
LAGREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSTDRPERQQLK
EALEAMQDLAMYINEVKRDKETLKKISEFQSSIENLVITPHFLGGPSGEGLRASPRPPTQ
DSRDPYLFLFDKVVIVCKRRGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFY
LIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIRPDKANANHHSFQMYTFDKTTNCKAC
RMFLRGTFYQGYLCTKCGVGAHKECLEVTPPCKISSPADLDTSGAGPGPKMVAVQNYHGN
PPPPGKPVLTFQTGDVIELLRGDPASPWWEGRLVQTRKSGYFPSLSVKPCPVDGRPPIGR
PPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHI
KVVEKDSWIHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKYPYKARERAASRASSR
SPASCASYNFSLLSPQGLSFASQGSSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREG
DVVKIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGVQ
Download sequence
Identical sequences F6TWZ5
ENSECAP00000013813 ENSECAP00000013813 9796.ENSECAP00000013813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]