SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6TXY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6TXY1
Domain Number 1 Region: 16-193
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.11e-51
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000505
Further Details:      
 
Domain Number 2 Region: 188-321
Classification Level Classification E-value
Superfamily E set domains 9.33e-48
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6TXY1
Sequence length 466
Comment (tr|F6TXY1|F6TXY1_HORSE) RELB proto-oncogene, NF-kB subunit {ECO:0000313|Ensembl:ENSECAP00000018439} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=RELB OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
PLGRLVPPAPGPGPRPHLVISEQPKQRGMRFYECEGRSAGSILGESSTEASKTLPAIELR
DCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHISPRHSFNNPGQCVP
KKEIEAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPV
YDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQAD
VHRQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRK
RGMPDVLGELNSSDPHGIESKRRRKKPAFLDHFLPSQGSGPFLPPSALLPDTDFFPGTVS
LPGLEPPGGPDLLDDGFAYETTTPTLFMLDMLPPAPPLASAVTGNGGAGAAVGEPSGPEP
LTLDSYPAPGPGDGGTASLVGSNMFPNQYREAGFGGGLLSPGPEAT
Download sequence
Identical sequences F6TXY1
ENSECAP00000018439 9796.ENSECAP00000018439 ENSECAP00000018439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]