SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6TZS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6TZS0
Domain Number 1 Region: 296-416
Classification Level Classification E-value
Superfamily TIMP-like 7.22e-37
Family Netrin-like domain (NTR/C345C module) 0.00024
Further Details:      
 
Domain Number 2 Region: 34-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-35
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 3 Region: 155-268
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-32
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6TZS0
Sequence length 416
Comment (tr|F6TZS0|F6TZS0_MONDO) Procollagen C-endopeptidase enhancer 2 {ECO:0000313|Ensembl:ENSMODP00000026549} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=PCOLCE2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MRDASCIRSWLWLLLAASAQVSGQQPQERPVFTCGGILSGESGLIGSEGFPGVYPPNSKC
TWKITVPEGKVVVLYFRFLDLESDNLCRYDFVDVYNGHTNGQRIGRFCGTFRPGALVSNS
NKMLVQMISDANTAGNGFIAMFSAAEPNERGDQYCGGRLQRPTGSFKTPNWPDRDYPVGV
TCLWHIIAPKNQVIEVKFEKFDVEQDNYCRYDYVAVFNGGEINDAKRIGKYCGDRPPAPI
VSERNELLIQFLSDLSLTADGFIGHYKFRPKKLPTTTVLPITTTSPAPTSSRPTVALCQQ
KCRRIGTLESNYCSSNFVLAGTVITTMTKGGSLLATVSIINVYKEGNLAIQQAGKNMSTK
ITVVCKQCPLIRRGLNYIIMGQVDEDGRGKITPNSFIMNFKMKNQKILNALKNKRC
Download sequence
Identical sequences F6TZS0
13616.ENSMODP00000026549 XP_001372323.1.35504 ENSMODP00000026549 ENSMODP00000026549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]