SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6U0N8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6U0N8
Domain Number 1 Region: 195-269
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0000749
Further Details:      
 
Weak hits

Sequence:  F6U0N8
Domain Number - Region: 260-300
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0142
Family Leucine zipper domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6U0N8
Sequence length 313
Comment (tr|F6U0N8|F6U0N8_CALJA) Upstream transcription factor 2, c-fos interacting {ECO:0000313|Ensembl:ENSCJAP00000019421} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=USF2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
ELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQ
GDTAGAVSVVSTAAFAGGQQAVTQVGVDGAAQRPGPAAASVPPGPAAPFPLAVIQNPFSN
GGSPAAEAVSGEARFAYFPASGVGDTTAVSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQR
TIAPRTHPYSPKIDGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCNADNSKT
GASKGGILSKAGYIRELRQTNQRMQETFKEAERLQMDNELLRQQIEELKNENALLRAQLQ
QHNLEMVGESTRQ
Download sequence
Identical sequences F6U0N8
ENSCJAP00000019421 ENSCJAP00000019421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]