SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6U0W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6U0W8
Domain Number 1 Region: 543-785
Classification Level Classification E-value
Superfamily VPS9 domain 5.36e-48
Family VPS9 domain 0.00076
Further Details:      
 
Domain Number 2 Region: 14-137
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000083
Family SH2 domain 0.0047
Further Details:      
 
Weak hits

Sequence:  F6U0W8
Domain Number - Region: 305-363
Classification Level Classification E-value
Superfamily BRCA2 helical domain 0.0955
Family BRCA2 helical domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6U0W8
Sequence length 902
Comment (tr|F6U0W8|F6U0W8_MONDO) Ras and Rab interactor 3 {ECO:0000313|Ensembl:ENSMODP00000002584} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=RIN3 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
RGISVLEKLIATCPVWLQLDMDRDKAAQILQGETTGIFLVRRESNLKHMILSVQFPSVNE
SLSDVLEYNIKEEKSILYLEGSVLVFEDIFLIAFYCVSRDLLPFTLRLPQAILEANSFKE
LETISNLGLGFWDSSLNPRRRRDTTGELPKGSAPTAPPAASLRSPPRYADCSCEIELSIG
NDRLWFVNPIFIEDCGSPLPPEEPLLRSCQANLVPSVPPPCLPATVSSAPTAELPGKSSH
QPITPSPTVPPPPVSPGPLGEEGKKEAAVPSPVPKLLASKKSTRPAVPPRRRLSERTSLE
ESGIMKTERGDEIEGLRWEERQQSYSRSSPSSLSLQKATGAPRKAVEQVFQGEGPTKVSG
IGLGIQSRPEPQKSKQPPVPPPRKKRISRQLASYLPSQPETPEPTEDQFQGQPTPTLSVG
SSPPRGGPASNAVTPAEAKGSPQTLGSTELKGSLSSLADSVGTSAVTPDQDSYSTSSTED
DPDHFSSPSVKKKSSMILDKAKHRLSFVSLSNVFNAFLSSNRKLQKKVVELAQDNHSYFG
NLVQDYKVYSLEMMAKQSSSTEMLQEIRMMMTQLKSYLLQSTELKSLVDLALHSEEELEA
IVESALYKCVLKPLKEAINSHLQEIHSKDGTLQQLKGNQLVILATTTTDLGVTTSVPEVS
VMEKILHKFTSMHKAYSPEKKIAILLKSCKLIYDSMALGNPGKPYGADDFLPVLMYVLAR
SNLTEMLLNVEYMMELMDPALQLGEGSYYLTTTYGALEHIKNYDKITVTRQLSVEVQDSI
HRWERRRTLNKARASRSSVQDFICISFLEPDNQARTLASKSDTLAEQLRAQCAEKFEVDQ
HQDYRLFVLVDGKCFQLADDSLPHHIKAYLLKSEPKRDFHFIYKAVDRGETQTPTVKEPN
FL
Download sequence
Identical sequences F6U0W8
ENSMODP00000002584 13616.ENSMODP00000002584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]