SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6U2R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6U2R6
Domain Number 1 Region: 187-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000347
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 2 Region: 226-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000179
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 147-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000778
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 4 Region: 110-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000317
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  F6U2R6
Domain Number - Region: 77-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00458
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6U2R6
Sequence length 396
Comment (tr|F6U2R6|F6U2R6_HORSE) Delta like non-canonical Notch ligand 2 {ECO:0000313|Ensembl:ENSECAP00000009794} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=DLK2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
PSIRPSLLGPALTMPSGCRCLHLVCLLCILGAPVQPARADDCSASCDLAHGCCAPDGSCR
CDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCRNGGQC
VYDGGGEYHCVCPLGFHGRDCEHKAGPCEQAGSPCRNGGQCQDDNGYALNFTCRCLAGFV
GARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARC
RDRVHDFDCLCPSGYGGKTCELVLPVPDPTTTADSPLGPTSAVVVPATGPVPHSVGAGLL
RISVKEVVRRQEVGLGESSLVAVVVFGALTAALVLSTVLLTLRAWRRGICPPGPCCYPPP
HYAPARQDQECQVSMLPAGLPLPPDLSPEPGKTTAL
Download sequence
Identical sequences F6U2R6
ENSECAP00000009794 ENSECAP00000009794 9796.ENSECAP00000009794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]