SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6U7U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6U7U4
Domain Number 1 Region: 179-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000647
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 220-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000184
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  F6U7U4
Domain Number - Region: 144-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000537
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 64-122
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 0.0706
Family Creatinase/aminopeptidase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6U7U4
Sequence length 545
Comment (tr|F6U7U4|F6U7U4_MACMU) Oncoprotein induced transcript 3 {ECO:0000313|Ensembl:ENSMMUP00000026847} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=OIT3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MPPFLLLTCLFITGTSVSPVALDPCSAYISLNEPWRNTDHQLDESQGPPLCDNHVDGEWY
RFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEGDGIVQRQACASFNGNCCLWNTTVE
VKACPGGYYVYRLTKPSVCFHVYCGHFYDICDEDCHGSCSDTSECTCAPGTVLGPDRQTC
FDENECEQNNGGCSEICVNLKNSYRCECGVGRVLRSDGKTCEDIEGCHNNNGGCSHSCLG
SEKGYQCECPRGLVLSEDNHTCQVPVLCKSNAIEVSIPRELVGGLELFLTNTSCRGVSNG
THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDFIIRTSKLLIPVTCEFPC
LYTISEGYVPNLRNSPLEIMSRNHGIFPFTLEIFKDNDFEEPYREALPTLKLRDSLYFGI
EPLVHVSGLESLVESCFATPTSKIDEVLKYYLIRDGCVSDDSVKQYTSRDHLAKHFQVPV
FKFVGKDHKEVFLHCRVLVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQSQTLTGGPIR
IDWED
Download sequence
Identical sequences F6U7U4
9544.ENSMMUP00000026847 XP_001104470.1.72884 ENSMMUP00000026847 ENSMMUP00000026847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]