SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6U990 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6U990
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-34
Family Calponin-homology domain, CH-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6U990
Sequence length 127
Comment (tr|F6U990|F6U990_ORNAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSOANP00000004522} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN= OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
MEQWRQCGRWLIDCKVLPANHRVVWPAAGVFDLAQALRDGVLLCQLLHNLAPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISTVARLSLHSI
AQNKGIR
Download sequence
Identical sequences F6U990
ENSOANP00000004522 ENSOANP00000004522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]