SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UCP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UCP7
Domain Number 1 Region: 80-152
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6UCP7
Sequence length 383
Comment (tr|F6UCP7|F6UCP7_CALJA) Mesoderm posterior bHLH transcription factor 2 {ECO:0000313|Ensembl:ENSCJAP00000013156} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=MESP2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAQTPPPQSLLSRDHWIFAQGWGWAGHSDSTSPASSSDSSGSCPCDGARGLPQPAVLDRG
SQAAEAAPTTPRRARSGPAGGQRQSASEREKLRMRTLARALQELRRFLPPSVVPAGQSLT
KIETLRLAIRYIGHLSAVLGLSEESLQRRRLQRGEAGSSRGCPLCPDGGPAQAQTQTQRE
GLELGLGLGQGQGQGRGRVVRSWASWGSSPACPGARAAPERLGSGVHDADPWATPPYCPK
IQSPPYSSQGTTSDASLWTPPQSCPWTQPSPEPRNPPAPWTTPPATLELATVYQGLSVSP
ESCLSLGTPSLLPHPSCQRLQPQTPWGCWSHSTEVLPTSEDQGQGAAFQLSEASPPQSSA
LRFSGCPELWQEDLEGARVSIFY
Download sequence
Identical sequences F6UCP7
ENSCJAP00000013156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]