SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UDW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UDW8
Domain Number 1 Region: 187-263
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.27e-16
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6UDW8
Sequence length 327
Comment (tr|F6UDW8|F6UDW8_CALJA) Basic helix-loop-helix family member e22 {ECO:0000313|Ensembl:ENSCJAP00000016914} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=BHLHE22 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MERGLHLGAAAAGEDDLFLHKNLSASTRRLEAAFRSTPPGMDLLAPPPRERPTSSSSSPL
GCFEPADPEGAGLLLPPPGVPGLLVGSAGVGGDPTLSSLPAGAALCLKYGESASRGSVAE
SSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGAKAAEGCSNAHLHGGASVPPGGL
EKSKEQKALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYIL
MQAQALEEMRRLVAYLNQGQAISAASLPSSAAAAAAAAALHPALGAYEQAAGYPFSAGLP
PAASCPEKCALFNSVSSSLCKQCTEKP
Download sequence
Identical sequences F6UDW8
ENSCJAP00000016914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]