SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UE44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UE44
Domain Number 1 Region: 230-334
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.97e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 88-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000458
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.054
Further Details:      
 
Domain Number 3 Region: 5-52
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000903
Family HLH, helix-loop-helix DNA-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6UE44
Sequence length 597
Comment (tr|F6UE44|F6UE44_CALJA) Single-minded family bHLH transcription factor 2 {ECO:0000313|Ensembl:ENSCJAP00000004933} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=SIM2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGL
GDAWGQPSRTGPLDSVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPSDHDEMTAVLTAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGY
KVIHCSGYLKIRQFMLDMALYDSCYQIVGLVAVGQSLPPSAITEIKLHSNMFMFRASLDL
KLIFLDSRVTEVTGYEPQDLIEKTLYHHVHGCDVFHLRYAHHLLLVKGQVTTKYYRLLSK
RGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTEIEYKELQLSLEQVSTKSQDSWRTALS
TSQESRNNEPKKNTKMKTKLRTNPYPPQQYSSFQMDKLECGQLGNWRASPPASTPAPPEP
QLHSESSDLLYAPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFLS
TLPASGECQWHYANPLVPSSSSPAKNPPEPPVNTARHSLMPSYEVPSAAMRTFTEDTAAP
ELPEAHYREEPTLGPVKDARLSGSGLVLACAASECCSLPVLEPPGAQEHLPFVLINY
Download sequence
Identical sequences F6UE44
ENSCJAP00000002674 ENSCJAP00000004933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]