SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UF45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UF45
Domain Number 1 Region: 280-433
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.09e-26
Family DnaQ-like 3'-5' exonuclease 0.00092
Further Details:      
 
Domain Number 2 Region: 570-744
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.42e-20
Family Canonical RBD 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6UF45
Sequence length 847
Comment (tr|F6UF45|F6UF45_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000008758} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC100026373 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSLGWLEPGKEGLSMLTNVALYSKDKREPQTLVGQRRKRSLLGRRMDAALIGKSKKRKQP
QNEFFIGSGEETTNGDPDDEESQPKWKKARLSTKLFVNNYEISHDQLRELLKSAALGKLS
ISDEQGAPNLSWCHLSHPKHLNSVVVIVLQGVSQLHFYKFFLQFKHLRKAFRHRFRLPAP
SANFLADVIGEQPNGNKEERILPTPNTMQVSSSLTSPQAITDLHSDPIIQKYGYDKVGLV
RCLLTKEEMKKFDFPLQGLDTCKNFIPTECLGPVNDSSPLFGLDCEMCLTPNGNELTRVS
LVDAEGHCVMDELVKPDNKILNYLTRFSGITRKILKPVTTRLRDVQVKLKKLLPPDAVLV
GHSLNADLKALQMIHLNVIDTSLLFVRDLGRRFKLKFLAKAVLGKEIQCPDRVGHDSTED
AIATLELAQYFIKHGPRKIAEMKLDTAVHSQQSLASPKQKNTLPLCPSGPNKEASTDAMW
QKNAGILECLDLTGQKLLFLSQKAGGNAFTSSRFCRSILCTSDEEVLEQAQAEVPLSSFS
IIQFSQCPHPLSPSLTVEMHQKMKIKWAEMSTVYAGPFGENFCLKPLKKLFASFGPVHSM
EVILETDEPYLCIHYGVLEAAQLAIETLNGACVQGSRIKVQRPVQELTLDCDTIVSTLET
DPENESTIYVNGMKESYTKEDMSQKFSLLPSLEAIFLPVDPQSKKHKKYCFLKFRSFECA
QSALKILQGPTGLSWKLVCRKALTPNHLHEWICHSYPDPRSPQASDVVSLDPKEKSPSVN
KSPQGEELKIAMSRFDERVRKLHERLPPSTLCIVLLPGMQSVHGSSAGLGLISVNGDDRK
SAVPEGL
Download sequence
Identical sequences F6UF45
ENSMODP00000008758 ENSMODP00000008758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]