SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UG05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UG05
Domain Number 1 Region: 262-475
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-54
Family Nuclear receptor ligand-binding domain 0.00000000306
Further Details:      
 
Domain Number 2 Region: 147-225
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.22e-26
Family Nuclear receptor 0.0000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6UG05
Sequence length 481
Comment (tr|F6UG05|F6UG05_MACMU) Estrogen receptor beta {ECO:0000313|Ensembl:ENSMMUP00000030075} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ESR2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVESHHEYPAMTFYSPAVMNYSSPS
NVTNLEGGPGRQTASPNVLWPTPGHLSPLAVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNRCTSPVTSPSSKRDAHFCAVCSDFASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CASKAKRSGSHAPLVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSNMYPLVTATQDA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHARWGEKQFIHLKL
S
Download sequence
Identical sequences F6UG05
ENSMMUP00000030075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]