SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UGD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UGD4
Domain Number 1 Region: 44-250
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.63e-44
Family Eukaryotic proteases 0.0000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6UGD4
Sequence length 251
Comment (tr|F6UGD4|F6UGD4_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000014544} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC103103225 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MVEKQRKGTNMNTILFFGLLSLAVTHLADKKNENSGTKFLAYLKSDYQPCVGTLIHQQWV
VTAAHCYLPFLQVKIGSPNENIKGWLQDQEINYEFLFRHPNFTADSPEHDIMLIKLAKSN
NQHVLVDLPTSINDLDGSICVISGWSQNWKYPFTDADIQINQMARWLSPVQCKGASPRNI
TARSMNNMFCAGMYPHQQNVCQEVSASAAICKGQLHGILSWTDGCVLKGDIGYYTKVYKY
RNWILDIIEKN
Download sequence
Identical sequences F6UGD4
ENSMODP00000014544 ENSMODP00000014544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]