SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ULP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ULP7
Domain Number 1 Region: 30-99
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000553
Family BphP N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6ULP7
Sequence length 227
Comment (tr|F6ULP7|F6ULP7_CALJA) PAS domain containing repressor 1 {ECO:0000313|Ensembl:ENSCJAP00000042189} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PASD1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
KDKVNPESSQKKSFDTYDDSNQMMLQSLDGFMITLSTDGVIIYVDENISPLLGHMPSATV
DKKLLSLLPDAEKNKVSEKIILKFPLFNSETHIEFCCHLKRGNVEHGDGPAYEYVKFILN
VKHICNESAVFFSSFCSSRRYAALSAKHITWEDQFYLMGIVCVLRTQLLKRLYTRSKVTD
KFILTQESDEESFVKDLSGSQDEGGHTSMEVVCAEPAAAAAAAATLD
Download sequence
Identical sequences F6ULP7
ENSCJAP00000042189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]