SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UMN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UMN6
Domain Number 1 Region: 391-511
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.92e-18
Family Mannose 6-phosphate receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 197-259
Classification Level Classification E-value
Superfamily EF-hand 0.0000729
Family Polcalcin 0.078
Further Details:      
 
Weak hits

Sequence:  F6UMN6
Domain Number - Region: 30-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00017
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 351-396
Classification Level Classification E-value
Superfamily Tropomyosin 0.00262
Family Tropomyosin 0.012
Further Details:      
 
Domain Number - Region: 128-223
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00994
Family FCH domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6UMN6
Sequence length 526
Comment (tr|F6UMN6|F6UMN6_CALJA) Protein kinase C substrate 80K-H {ECO:0000313|Ensembl:ENSCJAP00000010250} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PRKCSH OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
EMLPLLLLLPLCWAVEVKRPRGVSLTTHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCGKVEGGTNKLGSLLVCPLHCREK
GRKERESLQQMAEVTREGFRLKKILIEDWKKAREEKEKKLIELQAGKKSLEDQVEMLRTV
KEEAEKPEKEAKEQHQKLWEEQLAAAKAQREQELAADAFQELDDDMDGMVSLTELQTHPE
LDTDGDGALSEAEAQALLSGDIQTDATSFYDRVWAAIRDKYRSEALPTDLPAPSAPDLME
PKEEQPPVPSPPSEVQGEQPKVCVWGRSGDREGREAPPPLAPPQPASPSEEDKMPPYDEQ
TQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPDGEFAYLYSQCYELTTTE
YVYRLCPFKLVSQKPKLGGSPTSLGTWGSWAGPDHDKFSAMKYEQGTGCWQGPNRSTTVR
LLCGKETMVTSTTEPSRCEYLMELMTPAACPVPPPEAPTEGDHDEL
Download sequence
Identical sequences F6UMN6
ENSCJAP00000010250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]