SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UN99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UN99
Domain Number 1 Region: 22-216
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.42e-59
Family Astacin 0.0000993
Further Details:      
 
Domain Number 2 Region: 488-598
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-37
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 649-755
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-37
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 338-441
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-36
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 5 Region: 223-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-35
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 6 Region: 779-872
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 7 Region: 596-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000301
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 8 Region: 443-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000791
Family EGF-type module 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6UN99
Sequence length 883
Comment (tr|F6UN99|F6UN99_MONDO) Metalloendopeptidase {ECO:0000256|RuleBase:RU361183} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=TLL2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
PKASPATPVESSPRVRRATTSRTERIWPGGVIPYVIGGNFTGHQRAIFKQAMRHWEKHTC
VTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWH
EHTRPDRDQHVTIIRENIQQGKEYNFLKMEAGEVNSLGETYDFDSIMHYARNTFSRGVFL
DTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGNFSAPGFPNGYP
SYSHCVWRISVTPGEKIILNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLLGEFCGDKVPE
PLISTDSRLWVEFRSSSNILGKGFFAVYEAICGGEINKDAGQIQSPNYPDDYRPSKECIW
KITVSEGFHVGLTFQAFEIERHDSCAYDYLEIRDGATEDSVLIGHFCGYEKPDDIKSSSN
KMWMKFVSDGSINKAGFAANFFKEVDECSWPDRNGCEQRCVNTLGSYKCACDPGFELTAD
KKTCEVACGGFMTKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDV
CKYDYVEIRSGLSSDSKLHGKFCGSEKPEVITSQSNNMRVEFKSDNTVSKRGFKAHFFSD
KDECSKDNGGCQHDCINTFGSYICQCKNGFVLHENGHDCKEAGCEHRLNSAEGTMASPNW
PDKYPSRKECTWNISSTPGHRVKITFNEFEIEQHQECAYDHLEMYDGPNSKSPILGRFCG
SKKPDPVVASTNRMFLRFYSDASVQRKGFQARHSTECGGRLKAEVQTKDLYSHAQFGDNN
YSGHSRCDWVIAAEDGYGVELIFQTFEVEEEADCGYDYMEAFDGYDSTAPRLGRFCGSGP
LEEIYSAGDSLMIRFHTDDTINKKGFHARYTSTKFQDALHMRK
Download sequence
Identical sequences F6UN99
13616.ENSMODP00000005726 ENSMODP00000005726 ENSMODP00000005726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]