SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UPJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UPJ3
Domain Number 1 Region: 186-329
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 82-187
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-36
Family Second domain of FERM 0.000000883
Further Details:      
 
Domain Number 3 Region: 1-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-25
Family First domain of FERM 0.00000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6UPJ3
Sequence length 651
Comment (tr|F6UPJ3|F6UPJ3_HORSE) Erythrocyte membrane protein band 4.1 {ECO:0000313|Ensembl:ENSECAP00000020260} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=EPB41 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MHCKVSLLDDTVYECVVEKHAKGQDLHKRVCEHLNLLEEDYFGLAIWDNTTSKTWLDPAK
EIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLG
SYTVQSELGDYDPELHGADYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLEN
AKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFI
KIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFRY
SGRTQAQTRQASALIDRPAPHFERTASKRASRSLDGAAAVDSADRSPRPTSAPAIAQSQV
TEGAPVKKAGVSKAQKETAEAEVKGEEVPPEQAEPEPTEVQKVEKTHIEVTVPTSNGDQT
QKLAEKTEDLIRMRKKKRERLDGENIYIRHSNLMLEDLGKSQEEIKKHHASISELKKNFM
ESVPEPRPSEWDKRLSTHSPFRTPNINGQIPTGEGPPLVKTQTVTISDTANAVKSEIPTK
DVPIVHTETKTITYEAAQTDDSNGDLDPGVLLSAQTITSETTSSTTTTQITKTVKGGISE
TRIEKRIVITGDADIDHDQVLVQAIKEAKEQHPDMSVTKVVVHQETEISEE
Download sequence
Identical sequences F6UPJ3
ENSECAP00000020260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]