SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UPY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UPY6
Domain Number 1 Region: 31-93
Classification Level Classification E-value
Superfamily BPTI-like 6.24e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6UPY6
Sequence length 96
Comment (tr|F6UPY6|F6UPY6_HORSE) Serine peptidase inhibitor, Kunitz type 4 {ECO:0000313|Ensembl:ENSECAP00000020243} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SPINT4 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MKTAELRFLLGLFILFLLTTQLMGGVTRLTEMICGELKDPCNMDLKLGSCYEVHFRYFYN
KTSKRCESFVYTGCDGNLNNYKLIIDCNIACVEAYQ
Download sequence
Identical sequences F6UPY6
ENSECAP00000020243 9796.ENSECAP00000020243 ENSECAP00000020243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]