SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UQB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UQB2
Domain Number 1 Region: 344-586
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.05e-79
Family Eukaryotic proteases 0.0000725
Further Details:      
 
Domain Number 2 Region: 192-298
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-34
Family Kringle modules 0.00047
Further Details:      
 
Domain Number 3 Region: 33-85
Classification Level Classification E-value
Superfamily Kringle-like 1.54e-18
Family Fibronectin type II module 0.0021
Further Details:      
 
Domain Number 4 Region: 90-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000684
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  F6UQB2
Domain Number - Region: 126-160
Classification Level Classification E-value
Superfamily FnI-like domain 0.0544
Family Fibronectin type I module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6UQB2
Sequence length 588
Comment (tr|F6UQB2|F6UQB2_MONDO) Coagulation factor XII {ECO:0000313|Ensembl:ENSMODP00000005582} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=F12 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MQILLLLGILMLGLGPALTAPPWKTSKDPFTTAVLVTSGEPCYFPFQYRGQLHHRCTKKG
RPGPHAWCATTDNYDRDQQWVYCLESKKVKDHCKQNPCQRGGTCINTVHGARCLCAPHLM
GQYCQKEKCYQPQLRQFFNENETWLRAEPPRVAKCQCKGPSADCKWLPNSQGCLDNPCLH
GGMCLEAEGQSVCHCPPNYVGHFCEIDTSARCYNGQGLTYRGTAQTTLSGKQCQPWSSEI
TYQHLSREHVLTMGLGNHPYCRNPDNDTSPWCFVFSGTQLSWEYCRLTQCQDPTQNPAIA
SQYPTLPPPLSFTALPKEGLVSQAPGWKIDSVACGQRQRKRLSGLNRVMGGLVALPGAHP
YIAALYLGQNFCAGSLISACWVLTAAHCLEDRPAPELLKVVLGQQRHNESCQQCQEFSVR
EYRLHEHFQTHTFQHDIALVRLQEREDGNCARFSPFVQPVCLPETVEPPGDASSCQVAGW
GYQYEEAEDYASYLQEAEIPIISQERCSAKDVHGTSVTRDMLCAGFLEGGTDACQGDSGG
PLVCEEKEGRLTLRGVVSWGSGCGNRNKPGVYADVASHLEWIRERVAF
Download sequence
Identical sequences F6UQB2
ENSMODP00000005582 ENSMODP00000005582 XP_007474213.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]