SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6URI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6URI2
Domain Number 1 Region: 43-95
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000969
Family CUE domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6URI2
Sequence length 386
Comment (tr|F6URI2|F6URI2_CALJA) CUE domain-containing protein 1 {ECO:0000313|EMBL:JAB26315.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=CUEDC1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MTSLFRRSSSGSGGGGTAGARGGGGGGGAAAPQELNNSRPARQVRRLEFNQAMDDFKTMF
PNMDYDIIECVLRANSGAVDATIDQLLQMNLEGGGSGVYEDSSDSEDSIPPEILERTLEP
DSSDEEPPPVYSPPAYHMHMFDRPYPLAPPTPPPRIDALGSGAPTSQRRYRNWNPPLLGN
LPDDFLRILPQQLDSIQGNAGGPKPGSGEGGLPAMAGSGPRDQESRWKQYLEDERIALFL
QNEEFMKELQRNRDFLLALERDRLKYESQKSKSSSVSVGNDFGFPSPVPGTGDANPAVSE
DALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLRHHSLGAAASTANLLDDVE
GHACDEDFRGRQREAPKVEEGLREGQ
Download sequence
Identical sequences F6URI2
ENSCJAP00000025774 XP_002748438.1.60252 ENSCJAP00000025780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]