SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UTZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UTZ6
Domain Number 1 Region: 323-402
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000206
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.029
Further Details:      
 
Weak hits

Sequence:  F6UTZ6
Domain Number - Region: 911-969
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.00902
Family C-terminal domain of PLC-beta 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6UTZ6
Sequence length 1230
Comment (tr|F6UTZ6|F6UTZ6_HORSE) SUN domain containing ossification factor {ECO:0000313|Ensembl:ENSECAP00000001528} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SUCO OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
LPSWRVCCKESSSASSYYSQDDNCALENEDVQFQKKDEREGPINAELSGKVGSNLPIPPE
EHKLKDDYIVDVQNTESETLSPSVIETLPAVDLHEDSSSVVVGSENTENTSSSSTSEITP
VSKLDEIEKSGTIPIAKPRETEQSETDCDVGETLEANAPVDQPAFVNPPESLVGQHIENV
SSSHGKGKITKSEFESKVSASDQSNGDPKSALNASDNLKNESSDYTKPGEIDPTSVTSPK
DPEDIPTFDEWKKKVMEVEKEKSQSMHPSSNGGLHATKKVQKNRNNYASVECGAKILAAN
PEAKSTSAILIENMDLYMLNPCSTKIWFVIELCEPIQVKQLDIANYELFSSTPKDFLVSI
SDRYPTNKWIKLGTFHGRDERNVQSFPLDEQMYAKYVKMFIKYIKVELISHFGSEHFCPL
SLIRVFGTSMVEEYEEIADSQYQSERQELFDEDYDYPLDYNNGEDKSSKNLLGSATNAIL
NMVNIAANILGAKTEDLMEGNKSISENATATTPPKMPESAPVPTPVPSPEFVTTEGHVHD
TQPSSPDTPKESPIVQLVQEEEEEASPSTVTLLGSGEQEDESSPWFESETQIFCSELTTI
CCISSFAEYIYKWCSVRIALYRQRSRTDVSKEKDYLVSAQPPLLLPAESVDVSVLQPPSG
ELDGKSKEKETETTVLGDLSDMHQGDLINHTVDAIELEPSHPQTLSQSVLLDVTPEINSL
SKTELSEPIKYEAGHTPSQVITQESSVEVDNETEKKSESFSSVEKSTVIYETNKLNEVMD
NIVKEDLNSMQIITKLTETIVPPVNTATVPDSEDGEAKMSVADTPKQILTPVVDSSSVPE
VKEEEQSPEDALLRGLQRTATDFYAELQNSTDLGYANGNLVHGSNQKESVFMRLNNRIKA
LEVNMSLSGRYLEELSQRYRKQMEEMQKAFNKTIVKLQNTSRIAEEQDQRQTEAIQLLQA
QLTNMTQLVSNLSTTVAELKREVSDRQSYLVISLVLCVVLGLMLCMQRCRNTSPFDGDYI
SKLPKSNQYPSPKRCFSSYDDMNLKRRTSFPLIRSKSLQLTGKEVDPNDLYIVEPLKFSP
EKKKKRCKYKTEKIETIKPADRLHPIANGDIRGRKPFTNQRDFSNMGEVYHSSYKGPPSE
GSSETSSQSEESYFCGISACTSLCNGQSQKTKTEKRALKRRRSKVQDQGKLIKTLIQTKS
GSLPSLHDIIKGNKEITVGTFGVTAVSGHI
Download sequence
Identical sequences F6UTZ6
ENSECAP00000001528 9796.ENSECAP00000001528 ENSECAP00000001528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]