SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UU66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UU66
Domain Number 1 Region: 221-460
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-71
Family Nuclear receptor ligand-binding domain 0.000000000651
Further Details:      
 
Domain Number 2 Region: 18-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-31
Family Nuclear receptor 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6UU66
Sequence length 469
Comment (tr|F6UU66|F6UU66_XENTR) RAR related orphan receptor B {ECO:0000313|Ensembl:ENSXETP00000045673} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=rorb OC=Silurana.
Sequence
KVHCQLSCLVSLSAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQ
RNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQ
QQSGEAEALARVYSSNISNGLSNLNNDTGGTYANGHVIDLPKSEYYSVDSAQPSPDQSGI
DMTGMKQIKQEPIYDLTSVPNLFMYSSFNNGQMSPGISMSEIDRVAQNIIKSHLETCQYT
VDELHQLAWQTHTYEEIKIYQNKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQND
QILLLKSGCLEVVIVRMCRAFNPLNNTVLFEGKYGGMQMFKSLGSDDFVNEAFDFAKSLC
SLQLTEEEIALFSAAVLISPERPWLIEPRKVQKLQERIYFALQHVIQKNHLDDETLAKLI
AKIPNITALCNLHGEKLQVFKQTHPEIVNTLFPPLYKELFNPDSSTSCK
Download sequence
Identical sequences F6UU66
ENSXETP00000045673 ENSXETP00000045673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]