SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UUA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UUA0
Domain Number 1 Region: 213-452
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-70
Family Nuclear receptor ligand-binding domain 0.00000000116
Further Details:      
 
Domain Number 2 Region: 15-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.85e-32
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6UUA0
Sequence length 464
Comment (tr|F6UUA0|F6UUA0_XENTR) RAR-related orphan receptor A {ECO:0000313|Ensembl:ENSXETP00000045670} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=rora OC=Silurana.
Sequence
INSLLYSHSTAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNC
LIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQRDHQQPP
GEAEPLNPAGYGLTPNGLTELRDDLGGYMEEESKNDSTVNSFYLDIQPSPDQSGLDVNGI
KPEPLCDYTPASSFFPYCSFTNGETSPTISMAELEHLAQNISKSHMETCQYLREELQQLM
WQTFLQEEIDNYQSKQREVMWQLCAVKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAG
SLEVVFIRMCRAFDSQNNTVYFDGKYAGIEVFKALGCEDFISFVFEFGKSLCSLHLTEDE
IALFSAFVLMSGDRSWLQEKMKIEKLQQKIQLTLQHVLQKNHREDGILTKLICKVSTLRA
LCGRHAEKLMAFKAIYPDIVRHHFPPLYKELFTSEYEPAMQLEG
Download sequence
Identical sequences F6UUA0
ENSXETP00000045670 ENSXETP00000045670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]