SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UWL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UWL7
Domain Number 1 Region: 69-335
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.91e-54
Family beta 1,4 galactosyltransferase (b4GalT1) 0.000000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6UWL7
Sequence length 344
Comment (tr|F6UWL7|F6UWL7_MACMU) Beta-1,4-galactosyltransferase 5 {ECO:0000313|EMBL:EHH19607.1, ECO:0000313|Ensembl:ENSMMUP00000002826} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_02306 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MMQAQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPE
DFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKV
AILIPFRNRHEHLPVLFRHLIPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKD
LDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFR
KINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALL
RKSKERQGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY
Download sequence
Identical sequences A0A0D9RR85 F6UWL7 G7PG15
9544.ENSMMUP00000002826 ENSMMUP00000002826 ENSMMUP00000002826 XP_011784219.1.43180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]