SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UWN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UWN5
Domain Number 1 Region: 198-316
Classification Level Classification E-value
Superfamily EF-hand 2.21e-35
Family Osteonectin 0.0087
Further Details:      
 
Domain Number 2 Region: 286-379
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.67e-26
Family Thyroglobulin type-1 domain 0.00064
Further Details:      
 
Domain Number 3 Region: 135-180
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000846
Family Ovomucoid domain III-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6UWN5
Sequence length 424
Comment (tr|F6UWN5|F6UWN5_MACMU) SPARC/osteonectin, cwcv and kazal like domains proteoglycan 2 {ECO:0000313|Ensembl:ENSMMUP00000002824} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=SPOCK2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MHAPGCGRLVLPLLLLTAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNR
FRDEVEDDYIKSWEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHR
IKQPTVKLHGNKDSICKPCHMAQLASVCGSDGHTYSSVCKLEQQACLSNKQLAVRCDGPC
PCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSAASPASGLDK
SLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKYEVCIRPFFNSCDTYKDGRVSTA
EWCFCFWREKPPCLAELERVQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQ
LGLELTGTRTHGSPDCDDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEEEEGEAGEADDG
GYIW
Download sequence
Identical sequences F6UWN5
XP_001105299.1.72884 9544.ENSMMUP00000002824 ENSMMUP00000002824 ENSMMUP00000002824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]