SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UZP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UZP7
Domain Number 1 Region: 193-274
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.83e-19
Family HLH, helix-loop-helix DNA-binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6UZP7
Sequence length 276
Comment (tr|F6UZP7|F6UZP7_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000004912} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
QKYASIIRRDYMWSGFSARERLERAVSDRLAAGAPRGNQLKTSATPDCTPSLEAGPLGEP
KTQACSGSESPSDSETENEEIDIVTVEKRQSLAIRKPVTITVRADPLDPCMKHFHISIHQ
QQHNYAARFPPESCSQEEAPERSPQEEALERDAPLGEKEDEEDEEIVSPPPVESEATQSC
HPKPVSSDTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALE
YLQALVGAEKRMATEKRQLRCRQQQLQKRIAYLSGY
Download sequence
Identical sequences F6UZP7
ENSCJAP00000004912 ENSCJAP00000004912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]