SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6UZV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UZV0
Domain Number 1 Region: 629-902
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.9e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000579
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-34
Family Third domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-33
Family Second domain of FERM 0.0002
Further Details:      
 
Domain Number 4 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.19e-20
Family First domain of FERM 0.0022
Further Details:      
 
Domain Number 5 Region: 508-597
Classification Level Classification E-value
Superfamily PDZ domain-like 9.99e-20
Family PDZ domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6UZV0
Sequence length 913
Comment (tr|F6UZV0|F6UZV0_HORSE) Tyrosine-protein phosphatase non-receptor type {ECO:0000256|PIRNR:PIRNR000927} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=PTPN3 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MTSRLRALGGRINNIRTSELPKEKTRSEVICSICFLDGLVQTFKVNKQDTGQVLLDMVYN
HLGVTEKEYFGLQHGDDSVDSPRWLESSKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSQFIPDQ
SDDFVTKVESLHKQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHSLDLMIGIASSG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQTESREHIVAFNMLNYRSCKNLWKS
CVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNSKKSVNNQCCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
SPKDSDSEVSQNRSPHRKSVSENNPAHSCLTRKSSSSVSPSSNAPGSCSPDGVDQQFLED
FHRVTKGGSSEDSSQYYCDKNDNGDGYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELALVIRRKAVH
SFADIKSEDELNELFPEAIFPVCPEGGDTLEGSMEQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASSVNMEIPPAHLVNKYIATQGP
LPHTCAQFWQVIWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMEYGSFHIRCQSEDCT
IAYVFREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDPSDFLEFVNYVRSLRVDGEPVLV
HCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVPMLDPS
Download sequence
Identical sequences F6UZV0
ENSECAP00000006604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]