SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6V172 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6V172
Domain Number 1 Region: 315-351
Classification Level Classification E-value
Superfamily PH domain-like 0.000000467
Family Ran-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6V172
Sequence length 398
Comment (tr|F6V172|F6V172_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000030992} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=RANBP3 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MADLANEEKPAIAPPVFVFQKDKGQKRSAGGSSPEGGEDSDREDGNYCPPVKRERTSSLT
QFPPSQSEERSSGFRLKPPTLIHGQAPSAGLPSQKPKEQQRSVLRPAVLQAPQPKALSQT
VPSSGTNGVSIPADCTEAVPAASPDNPARRSPSEAADEVCALEEKEPQKNESGNASEEEA
CEKKDPATQQAFVFGQNLRDRVKLINESADEADMENAGHPSADTPAATNYFLQYISSSLE
NSTNSADASSNKFVFGQNMSERVLSFPKLNEVSSDASRENAAAESGSESSSQEATPEKES
LAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKASQSWLCRRPHPSLP
AAAPRPCGEQPLAFCLRPGVSNYRPGTPAQPGELLTRV
Download sequence
Identical sequences F6V172
ENSCJAP00000030992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]