SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6V1I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6V1I2
Domain Number 1 Region: 298-405
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-22
Family SH2 domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6V1I2
Sequence length 419
Comment (tr|F6V1I2|F6V1I2_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000038322} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
RGNRKTTKEGSTLLKSQNLGLSPNRSWPHIGAAAGQHRTISENCSSYDKSIVKVADGAKD
SDGEDYEDPKTLPIGAFRSTKILPARPIEESQYADIRCFQEKMNSHISTDTKNNVSMKQQ
PWNFQMRLEKGVQILADVRDLNHKGESEIKGIKNPLPPPRPPNTLPKKYRPLPPEPENRL
TLNQRNDLLEADKSTRQISLKDLSDVINSNDNTRNISRLTHKLDLSEAVLNKVINLTASS
ESSKSNGKTKVRMRHKVSMSSPSLQKASQPAHGNLLDDKPLPTSLLQKKPYHGKCSKKAF
KTYDWYIGEFSRQEVEKALMKENTDGTFLVRDSSKKSMAEPYVLVVFHRNKVYNVKIRFL
EGSQQFALGTGLRGDDKFDSVEDIIEYYKLFPIVLIDGKDQTGTHREHCYLKKPLSLSR
Download sequence
Identical sequences F6V1I2
ENSMODP00000038322 13616.ENSMODP00000038322 ENSMODP00000038322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]