SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6V1X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6V1X5
Domain Number 1 Region: 99-213
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-31
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 2 Region: 22-121
Classification Level Classification E-value
Superfamily Fibronectin type III 1.46e-19
Family Fibronectin type III 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6V1X5
Sequence length 330
Comment (tr|F6V1X5|F6V1X5_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000026344} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=IL10RB OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MERSFQTWLYSSCLLISVLGILPKPRNVRMNSVNLKNILQWDPPAFYQGNVTYRAQYESY
RSFEDVCTNIIITECNFSNISKYGESKMRVRTESVDEQSEWVNLTFCPLEDTIIGPPGIQ
VEPLAGSLHLYFSYPKIENEPNIWTLRDYYYSWTYRVIYWKNGTSHKFEKNAPYDSEVLT
DLDPWTVYCIQAQGFITSKNKSGEWSQPICVQTTDNESPPYWITIIVLIVSMIVVLLTAL
GCFSLLWYFYRKAKCIFFPGYSFPQPLKEYLEQHPYRISFLSPVPSSESESFDKLSIIKL
SENTEHDTTGPCNYSKEELQQSLLSGEKNS
Download sequence
Identical sequences F6V1X5
XP_007493332.1.35504 ENSMODP00000026344 ENSMODP00000026344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]