SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6V355 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6V355
Domain Number 1 Region: 262-376
Classification Level Classification E-value
Superfamily SEA domain 7.32e-20
Family SEA domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6V355
Sequence length 483
Comment (tr|F6V355|F6V355_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000021333} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MTPGIQPTVVLVLFLANLASLTLIAIIHSTSGTNNGLDSMMANYEKTSGNRNKNNMNLSI
RTPTVASSIFASTTHQSTTVTSDTYPSTTSTSTIHQSTTVTSSIPPTTPSTHTIYPSTIS
RPTSNHSTISTHTSHHSTLSRPTSNHSTISTPTNHHSTISRPTSNHSTISTPTSHHSTIS
RPTSNHSTISTPTSHHSTISRPTSNHSTISRPTITAPKHHPATTGNPKSISSTIHQIATS
GPNNNHSSISQSITISQSTSHHPAVVIAENSMFFLSFRILSKNFNSSLENPSSLYYQELK
NSLSDLLQQIYKNKAFMTFYLLQFRMGSVVTDCILVFQEGSITASEVQNLFAENLKKGYI
YNLNISSSDIIVRDWNSKTSSTGSSVPGYGIALLVIVCILLALAILHLAVMGLCQFRRKH
CGQLDIFPSQDSYHPMNEYPLYHTHGRYVPPGNTKRSPYEEISPGNGGNSLSYVNPVATS
ANL
Download sequence
Identical sequences F6V355
ENSMODP00000021333 ENSMODP00000021333 13616.ENSMODP00000021333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]