SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6V5A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6V5A2
Domain Number 1 Region: 400-619
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-51
Family DBL homology domain (DH-domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 610-740
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000486
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6V5A2
Sequence length 842
Comment (tr|F6V5A2|F6V5A2_CANLF) Rho guanine nucleotide exchange factor 15 {ECO:0000313|Ensembl:ENSCAFP00000025113} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ARHGEF15 OC=Canis.
Sequence
MSAQSLPAATPPTQKPPRIIRPRPPSRPRAAASPGPHHNGSSPQEPALTSNDAGTPMCTP
IHWDSPAASLKPPALLPPSASKASLDSQTSPDSPSSTPSPASRRSVSPEPVPRSPVPPPK
PSGSHTLPLLPTVGVPAQGGSASAPGTVRRLAGRFEWGAESRVQAADALELGPQGAADVN
GEREAPQVNLGSSGSQENGTLDAGLACPPCCPCVCHIGRPGLELRWVPVGGYEDGPRAFC
RASPLRASRSRPNPPSISLPPVVLTSYRSTAERKLLPPLKAPKPTWVRQDIAISGDPPKP
DLDLPSEDGIQTGDNPDEAPPSAPPAPVEGRDKEELEELKEQNWELPLQDEPLYQNYRAA
VLSEELWGVSEDGCPSPTNPGEAPTFARPPGPRNTLWQELPAVRASGLLDTLSPQERRMQ
ESLFEVVTSEASYLRSLRLLTDTFVLSQALRDTLTPRDHHTLFSNVQRVQGVSERFLGTL
LSRVRSSPHISDLCDVVHEHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQ
SLPKCERLPLPSFLLLPFQRITRLRMLLQNILRQTEEGSSRQENAQKALGAVSKIIERCS
AEVGRMKQTEELIRLTQRLRFHKVKALPLVSWSRRLELQGELTELGCRRGGVLFTSRPRF
TPLCLLLFSDLLLITQPKSGQRLQVLDYAHRSLVQAQQVPDPSGPPTFRLSLLSNHQGRP
THRLLQASSLSDMQRWLGAFPTPGPLPCSPDTVYEDCDCSQELCSEPSAPARTEGRGLES
RAPPRHPLKSPEGWLKGFPGAFPAQLVCEVTGEHERRKHLRQHQRLLEAVGPSSGSPSAP
PP
Download sequence
Identical sequences F6V5A2
XP_005620083.1.84170 XP_860396.1.84170 ENSCAFP00000025113 ENSCAFP00000025113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]