SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6V5X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6V5X0
Domain Number 1 Region: 80-122
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000253
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6V5X0
Sequence length 143
Comment (tr|F6V5X0|F6V5X0_CALJA) Rho GTPase activating protein 15 {ECO:0000313|Ensembl:ENSCJAP00000042555} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ARHGAP15 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MQKSTNSDTSVETLNSTRQGTGAIQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHR
RNHSQHVLKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWVVLSSRKIEFYKES
KQQALSNMKTGHKPESVDLWCTH
Download sequence
Identical sequences F6V5X0
ENSCJAP00000042555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]