SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6V8M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6V8M3
Domain Number 1 Region: 25-189
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0000000000114
Family Rhomboid-like 0.0089
Further Details:      
 
Domain Number 2 Region: 300-361
Classification Level Classification E-value
Superfamily UBA-like 0.000000102
Family UBA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6V8M3
Sequence length 385
Comment (tr|F6V8M3|F6V8M3_MONDO) Rhomboid domain containing 3 {ECO:0000313|Ensembl:ENSMODP00000029519} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=RHBDD3 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAPGRERQAPMMQMIRGLPLASSLLLLLLCCLWVLGAGPNLALDPDLLLGHWQVHRLLTF
PLGHTALPALLLSLLLFPTLGWYQESHLGTLRYVHASALSTVATGLLYLLLAGLGVPGAR
SAGCGFSPIHLALLAAQHRSRTRLPGGVVPPLLLLALMHLVSSEPPFLLQLCGLLSGLAY
SAGLFRRLELSERRLQTLQKARMCRALEGSCLLCFIPAPGSPLELPIVLTASRSPRHSDS
GALGNLMPGLWASSPAPALLAPGLGPFPFEASVFEGVPPAETLLWSHGDSVDDNLLQAAI
RASLQDEPAPGAPEELRLPKSSVSSLRLQQLERMGFSTEQAVVALAATGRVEGAVSLLVE
GQVGDAAQLAHSRGWPQMSPHPHPV
Download sequence
Identical sequences F6V8M3
ENSMODP00000029519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]