SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VFN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VFN4
Domain Number 1 Region: 27-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000025
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Weak hits

Sequence:  F6VFN4
Domain Number - Region: 83-140
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0861
Family Rhodopsin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6VFN4
Sequence length 155
Comment (tr|F6VFN4|F6VFN4_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000013090} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
AATLRLRTRPGGRAGDATAVPGNRTGTCAQVQPPPRGTLQLLRGDGASVGTVIVFHCPSG
HQMVGSGLLTCTWKGSIAEWSSGTPVCKAVPPSETFGFRVAVIASIVSSAIILLMSMAFL
TCCLLKCVKRSEQRRSDRRTSLCLQLREGDLETMQ
Download sequence
Identical sequences F6VFN4
ENSECAP00000013090 ENSECAP00000013090 9796.ENSECAP00000013090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]