SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VFP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VFP1
Domain Number 1 Region: 642-790
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-31
Family SPRY domain 0.000076
Further Details:      
 
Domain Number 2 Region: 23-116
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-29
Family RING finger domain, C3HC4 0.0062
Further Details:      
 
Domain Number 3 Region: 355-438
Classification Level Classification E-value
Superfamily RING/U-box 6.6e-23
Family RING finger domain, C3HC4 0.0037
Further Details:      
 
Domain Number 4 Region: 117-180
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-17
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 5 Region: 440-499
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000763
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6VFP1
Sequence length 792
Comment (tr|F6VFP1|F6VFP1_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000037426} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TRIM22 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
FAYLPRILQAGDILEIRAGQAGARKVATMTSTVLVDIQEEVTCPICLELLTEPLSLDCGH
SFCQACLTPNSRESMIGQEGERRCPVCQSSYQLGNLRPNRHLANIAGRLREVVLGAGKQL
KAVLCADHGEKLQLFCKDDGKVICWLCERSEEHRGHHTFLMEEVAQEYQEKFQESLKKLK
QEQQEAEKLTAFIREKRTTWKNQMEPERYRIQTEFNQLRNILDRAEQRELKKLEEEEKKG
LRIIEEAENDLVHQSQSLRELISDLERRCQGSTMELLQDARDVTESHDQWERSKHVLYHI
LQSLIRQDDISSLLLTCTELTDVQSYWGNHPGVFKQEERTSGVRTRRRQGSSAMASKILL
NLQEEVTCPICLKLLTEPLSLGCGHSLCQACITVNNKEAVTSCPVCGISYSFENLQANQH
LINIVERLREVKLSQDNGKKTDLCDCHGEKLLLFCKEDRKVICWLCERSQEHRGHHTFLM
EEVVKECQEKLHAILKRLRKEEEEAEKLEADIREKKTSWKYQVQTERQRIQTEFDQLRRI
LNSEEQRELQRLEEEEKKELDNLAQAEDDLVQQKQLVRELISDVECRSQWSTVELLQDVS
GIMKWSEIWRLRKPKTLSQKLKTVFRAPDLSRMLQMFRELTAVRCYWVDVTMNPVNLNLN
LVLSEDQREVTSVPIWPFQCYNFGILGSQXVYSKYRPLFGYWVVGLQNKRKYRAFEQSSS
SDSEVLTLSMAVPPCRVGVFLDYEAGIVSFFNVTSHGSLIYKFSKCCFSQPVYPYFNPWN
CPAPMTLCPPSS
Download sequence
Identical sequences F6VFP1
ENSCJAP00000037426 ENSCJAP00000037389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]